PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0359s0250.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRAS
Protein Properties Length: 547aa    MW: 61073.8 Da    PI: 5.4515
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0359s0250.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS410.81.3e-1251765461374
                    GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsev 87 
                             l+++Ll+cA+avs+ d ++a  l+  l +++s +g+p+qRl ay++e+L+arl  s+s++y+al++++     ss+ ++++ +++++
  SapurV1A.0359s0250.1.p 176 LKQVLLACADAVSNADIQRAAGLMHVLDQMVSVSGEPIQRLGAYMLEGLRARLELSGSKIYRALKCEAPI---SSDLMTYMGILYQI 259
                             5799*****************************************************************9...9999999******* PP

                    GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeel 172
                             +P+ kf++  aN  I eave e+r+HiiDf+i qG QW+ L+q La+Rp+gpp +RiTgv++++s   +   l  +g+rL+k+Ae++
  SapurV1A.0359s0250.1.p 260 CPYWKFAYTSANVVIREAVEYESRIHIIDFQIAQGSQWILLMQMLACRPGGPPAIRITGVDDSQSAhaRGGGLDIVGHRLSKVAESC 346
                             **************************************************************9988889999*************** PP

                    GRAS 173 gvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfle 259
                             +vpfef+  va +  +++le+Lrv++gEa++Vn+ + lh+++desv++ ++rd++++++kslsP++v++veqe+++n+++F+ rf+e
  SapurV1A.0359s0250.1.p 347 NVPFEFHD-VAMDGCEVQLEHLRVQSGEAVVVNFPYVLHHMPDESVNTWNHRDRLIRMMKSLSPRIVTLVEQESNTNTKPFFPRFIE 432
                             ********.6888999*********************************************************************** PP

                    GRAS 260 aleyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvks 346
                             +l+yy+a+f+s++a+ +++ ++ri+ E+++++r+ivn++ace+aer+erhe l+kWr+r+++aGF+++pls+++++ +k ll++++ 
  SapurV1A.0359s0250.1.p 433 TLDYYTAMFESIAAGGSKDVKQRINAEQQCVARDIVNMIACEEAERVERHELLAKWRSRFTMAGFNQYPLSSSTTTAVKDLLKEYD- 518
                             ************99989999******************************************************************. PP

                    GRAS 347 dgyrveeesgslvlgWkdrpLvsvSaWr 374
                             + y+v+e++ +l+l W++r + + SaW+
  SapurV1A.0359s0250.1.p 519 RNYSVQERDRALYLRWRNRDMATSSAWQ 546
                             55*************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.81150527IPR005202Transcription factor GRAS
PfamPF035144.4E-123176546IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MQTSQEHRSA GIHGFYHQPV QEINPYGFSR VQILDSNMYS DAGSQGTSVS FDTCLGQFVT  60
LESSSATSGF VVYDSPAASI SSNRSPFSPQ GSHSCISDPH HSPENIYGSP SSGSSSADED  120
NILRQKLREL EISLLGPESD ITDSGSFCFV SGGYQAEPSA SWDWNQMMEM IPRLDLKQVL  180
LACADAVSNA DIQRAAGLMH VLDQMVSVSG EPIQRLGAYM LEGLRARLEL SGSKIYRALK  240
CEAPISSDLM TYMGILYQIC PYWKFAYTSA NVVIREAVEY ESRIHIIDFQ IAQGSQWILL  300
MQMLACRPGG PPAIRITGVD DSQSAHARGG GLDIVGHRLS KVAESCNVPF EFHDVAMDGC  360
EVQLEHLRVQ SGEAVVVNFP YVLHHMPDES VNTWNHRDRL IRMMKSLSPR IVTLVEQESN  420
TNTKPFFPRF IETLDYYTAM FESIAAGGSK DVKQRINAEQ QCVARDIVNM IACEEAERVE  480
RHELLAKWRS RFTMAGFNQY PLSSSTTTAV KDLLKEYDRN YSVQERDRAL YLRWRNRDMA  540
TSSAWQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-511785466375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002308802.10.0hypothetical protein POPTR_0006s01720g
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLB9HCV90.0B9HCV9_POPTR; Uncharacterized protein
STRINGPOPTR_0006s01720.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43773360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13